PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G19540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 891aa    MW: 95677.3 Da    PI: 5.7143
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G19540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-20144199156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  OGLUM10G19540.1 144 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 199
                      688999***********************************************998 PP

2START129.93e-413595902206
                      HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT CS
            START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv................dsgealrasgvvdmvlallveellddkeqW 72 
                      la +aa++l ++  a+ep+Wv+ +       e           e ++                  + e  r+ +vv+m++ +lv  +ld + +W
  OGLUM10G19540.1 359 LAATAADQLARMCRAGEPLWVRQRgaevmavE-----------EHARMfswpvdgakqgdggavARAEGTRDNAVVIMNSINLVDAFLDAN-KW 440
                      678999******************66554333...........3333344444445567778888888888999*****************.** PP

                      -TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--...-TTSEE-EESSE CS
            START  73 detla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe..sssvvRaellpS 150
                       e ++    ka t++ i+ g        g+l lm+ae q+lsplv+ R++vf Ry+     +g+w+ivd   +  ++     ++svvR++++pS
  OGLUM10G19540.1 441 MELFPsivcKARTIQIINHGavsghlgsGTLLLMQAEVQFLSPLVAaREVVFFRYCVHnADEGSWAIVDFPAEGFEE--GllQASVVRCRRRPS 532
                      **********************************************************9999*******55555555..356************ PP

                      EEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 151 giliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                      g++i++++ng+s+v+wveh+++ g     + ++r  v sg+a+ga +w++ lqrqce+
  OGLUM10G19540.1 533 GCIIQDMPNGYSRVVWVEHMEMVGEEKplQPVFRDYVASGAAFGATRWLSILQRQCER 590
                      *********************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-19131202IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-22131195IPR009057Homeodomain-like
PROSITE profilePS5007117.167141201IPR001356Homeobox domain
SMARTSM003893.4E-19142205IPR001356Homeobox domain
CDDcd000867.11E-19144202No hitNo description
PfamPF000463.8E-18144199IPR001356Homeobox domain
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
PROSITE profilePS5084844.182349593IPR002913START domain
SuperFamilySSF559611.65E-28352592No hitNo description
CDDcd088754.43E-100353589No hitNo description
SMARTSM002341.1E-22358590IPR002913START domain
PfamPF018522.1E-33359590IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-4466556IPR023393START-like domain
SuperFamilySSF559612.06E-15615787No hitNo description
SuperFamilySSF559612.06E-15833872No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 891 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFASPLI PNPALAGFMS SSAAMPFHHF SNAAATLIPP  60
HDTAIYVRAV QKEEGLMGGL HVAKDEEMDL EMDMELSGGS GSAHLDGLLS FADVDDDHKP  120
QHSGHDQLPD AAQPSGAAGG NAKKKRYHRH TAHQIQQMEA LFKECPHPDD KQRLKLSQEL  180
GLKPRQVKFW FQNRRTQMKA QQDRADNVIL RAENENLKSD NFRLQAAIRN VVCPNCGHAA  240
VLADMSYEEQ QLRIENARLK DELDRLACIA TRYGGGGGRQ PVLSTSALSC ISAPPPVLMP  300
PLDLDMNVYS RHFAEQAPVM GCGDLIPPPV VPQHDGAAAY MGAMMAPVQE QDKQLVVDLA  360
ATAADQLARM CRAGEPLWVR QRGAEVMAVE EHARMFSWPV DGAKQGDGGA VARAEGTRDN  420
AVVIMNSINL VDAFLDANKW MELFPSIVCK ARTIQIINHG AVSGHLGSGT LLLMQAEVQF  480
LSPLVAAREV VFFRYCVHNA DEGSWAIVDF PAEGFEEGLL QASVVRCRRR PSGCIIQDMP  540
NGYSRVVWVE HMEMVGEEKP LQPVFRDYVA SGAAFGATRW LSILQRQCER LASELARNIA  600
DLGVIRTPEA RTNMMKLSQR MITTFCANIS ASGTQSWTAL SDSTQDTIRV TTRKNTEPGQ  660
PSGVILTAVS TSWLPFTHQQ VFELLADEQQ RCQLEILSNG GSLHEVAHIA NGSHPRNCIS  720
LLRINAASNS SQNVELLLQE SSTHPDGGSL VVFATVDVDA IQVTMSGEDP SYIPLLPLGF  780
AIFPATSPSP AAAPTISSST TTTTGNGNGE TSSTPPRNSS SNNNNADELL PPNGCLLTVG  840
MQVLASAVPS AKLNLSSVTA INSHVCNAIH QITAALKGSA GGAGGEPASD Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016460.0AB101646.1 Oryza sativa Japonica Group Roc3 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613461.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0E0BE520.0A0A0E0BE52_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031343-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7